Lineage for d5cfna_ (5cfn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948879Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 1948880Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 1948929Family d.387.1.0: automated matches [276281] (1 protein)
    not a true family
  6. 1948930Protein automated matches [276282] (1 species)
    not a true protein
  7. 1948931Species Nematostella vectensis [TaxId:45351] [276284] (7 PDB entries)
  8. 1948944Domain d5cfna_: 5cfn A: [276296]
    automated match to d4f5da_
    complexed with 2ba

Details for d5cfna_

PDB Entry: 5cfn (more details), 2.95 Å

PDB Description: crystal structure of anemone sting (nematostella vectensis) in complex with 3',3' c-di-amp, c[a(3',5')pa(3',5')p]
PDB Compounds: (A:) Stimulator of Interferon Genes

SCOPe Domain Sequences for d5cfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cfna_ d.387.1.0 (A:) automated matches {Nematostella vectensis [TaxId: 45351]}
snvadglawsyyfgylkfvlpelekqiektskfrskekfvkkmfilipsncfwddkipgs
dydpqnritfegnteplektrggvflrhykhsvyeikdgenepwfcimeyatplltlydm
svaqpgelsreerdaqvvvflrklqdilegdracqgkyelvtfspdrdladvmlrklkds
e

SCOPe Domain Coordinates for d5cfna_:

Click to download the PDB-style file with coordinates for d5cfna_.
(The format of our PDB-style files is described here.)

Timeline for d5cfna_: