Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.387: STING C-terminal-like [254119] (1 superfamily) 5 helices and 5 strands in one mixed beta-sheet, one long bent helix |
Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) Pfam PF15009, PubMed 22579474 |
Family d.387.1.0: automated matches [276281] (1 protein) not a true family |
Protein automated matches [276282] (1 species) not a true protein |
Species Nematostella vectensis [TaxId:45351] [276284] (7 PDB entries) |
Domain d5cfna_: 5cfn A: [276296] automated match to d4f5da_ complexed with 2ba |
PDB Entry: 5cfn (more details), 2.95 Å
SCOPe Domain Sequences for d5cfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cfna_ d.387.1.0 (A:) automated matches {Nematostella vectensis [TaxId: 45351]} snvadglawsyyfgylkfvlpelekqiektskfrskekfvkkmfilipsncfwddkipgs dydpqnritfegnteplektrggvflrhykhsvyeikdgenepwfcimeyatplltlydm svaqpgelsreerdaqvvvflrklqdilegdracqgkyelvtfspdrdladvmlrklkds e
Timeline for d5cfna_: