Lineage for d1qlga_ (1qlg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808366Superfamily b.68.3: Thermostable phytase (3-phytase) [50956] (1 family) (S)
    automatically mapped to Pfam PF02333
  5. 2808367Family b.68.3.1: Thermostable phytase (3-phytase) [50957] (2 proteins)
  6. 2808368Protein Thermostable phytase (3-phytase) [50958] (1 species)
  7. 2808369Species Bacillus amyloliquefaciens [TaxId:1390] [50959] (5 PDB entries)
  8. 2808372Domain d1qlga_: 1qlg A: [27627]
    complexed with ca, mg

Details for d1qlga_

PDB Entry: 1qlg (more details), 2.2 Å

PDB Description: crystal structure of phytase with magnesium from bacillus amyloliquefaciens
PDB Compounds: (A:) 3-phytase

SCOPe Domain Sequences for d1qlga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlga_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}
klsdpyhftvnaaaetepvdtagdaaddpaiwldpknpqnsklittnkksglavyslegk
mlhsyhtgklnnvdirydfplngkkvdiaaasnrsegkntieiyaidgkngtlqsitdpn
rpiasaidevygfslyhsqktgkyyamvtgkegefeqyelnadkngyisgkkvrafkmns
qtegmaaddeygslyiaeedeaiwkfsaepdggsngtvidradgrhltpdiegltiyyaa
dgkgyllassqgnssyaiyerqgqnkyvadfqitdgpetdgtsdtdgidvlgfglgpeyp
fglfvaqngenidhgqkanqnfkmvpweriadkigfhpqvnkqvdprkmtdrs

SCOPe Domain Coordinates for d1qlga_:

Click to download the PDB-style file with coordinates for d1qlga_.
(The format of our PDB-style files is described here.)

Timeline for d1qlga_: