Lineage for d4wkbb_ (4wkb B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1861590Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1861591Protein automated matches [190781] (36 species)
    not a true protein
  7. 1861823Species Vibrio cholerae [TaxId:345073] [276178] (2 PDB entries)
  8. 1861825Domain d4wkbb_: 4wkb B: [276179]
    automated match to d4qezb_
    complexed with tdi

Details for d4wkbb_

PDB Entry: 4wkb (more details), 1.37 Å

PDB Description: crystal structure of vibrio cholerae 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with methylthio-dadme- immucillin-a
PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4wkbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wkbb_ c.56.2.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
mkigiigamqqevailkdliedvqevnqagctfysgqiqgvdvvllqsgigkvsaalgta
llisqyapdvvintgsaggfdaslnvgdvvissevrhhdadvtafgyeigqmagqpaafk
adeklmtvaeqalaqlpnthavrglictgdafvctaerqqfirqhfpsvvavemeasaia
qtchqfkvpfvvvraisdvadkesplsfeeflplaaksssamvlkmvellkenlyfq

SCOPe Domain Coordinates for d4wkbb_:

Click to download the PDB-style file with coordinates for d4wkbb_.
(The format of our PDB-style files is described here.)

Timeline for d4wkbb_: