Lineage for d4r1qc2 (4r1q C:328-497)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792910Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 2792929Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 2792930Protein automated matches [227032] (5 species)
    not a true protein
  7. 2792935Species Geobacillus kaustophilus [TaxId:235909] [275932] (5 PDB entries)
  8. 2792938Domain d4r1qc2: 4r1q C:328-497 [275952]
    Other proteins in same PDB: d4r1qa1, d4r1qb1, d4r1qc1, d4r1qd1, d4r1qe1, d4r1qf1
    automated match to d2ajta1
    complexed with mn, sst

Details for d4r1qc2

PDB Entry: 4r1q (more details), 2.25 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase in complex with l-arabitol
PDB Compounds: (C:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1qc2 b.43.2.0 (C:328-497) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg
aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah
htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrgr

SCOPe Domain Coordinates for d4r1qc2:

Click to download the PDB-style file with coordinates for d4r1qc2.
(The format of our PDB-style files is described here.)

Timeline for d4r1qc2: