Lineage for d4zhgc_ (4zhg C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804448Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2804449Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)
  8. 2804490Domain d4zhgc_: 4zhg C: [275773]
    automated match to d1l6ma_
    complexed with 4ol, am, cl, gol, so4

Details for d4zhgc_

PDB Entry: 4zhg (more details), 2.05 Å

PDB Description: siderocalin-mediated recognition and cellular uptake of actinides
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4zhgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhgc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
stsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedk
synvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvf
fkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d4zhgc_:

Click to download the PDB-style file with coordinates for d4zhgc_.
(The format of our PDB-style files is described here.)

Timeline for d4zhgc_: