SCOPe 2.08: Domain d5c24b_: 5c24 B:

Lineage for d5c24b_ (5c24 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (206 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d5c24b_: 5c24 B: [275359]
   Other proteins in same PDB: d5c24a1, d5c24a2
   automated match to d2be2b_
   complexed with 4xo, mg, so4

Details for d5c24b_

PDB Entry: 5c24, 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7- ((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8- dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor

PDB Compounds: (B:) HIV-1 reverse transcriptase, p51 subunit

SCOPe Domain Sequences for d5c24b_:

Sequence; same for both SEQRES and ATOM records:

>d5c24b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglflwmgyelhpdkwtvqpivlpekdswtvnd
iqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhg
vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkit
tesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

Timeline for d5c24b_:

• d5c24b_ first appeared in SCOPe 2.05
  
• d5c24b_ appears in SCOPe 2.07