Lineage for d4xrqa1 (4xrq A:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003180Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2003181Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2003182Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2003221Protein HIV-1 capsid protein [47945] (1 species)
  7. 2003222Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2003276Domain d4xrqa1: 4xrq A:1-147 [275062]
    Other proteins in same PDB: d4xrqa2
    automated match to d2m8la1
    complexed with 1b0

Details for d4xrqa1

PDB Entry: 4xrq (more details), 1.95 Å

PDB Description: disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4xrqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xrqa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfaalscgatpqdlntmlntvg
ghqaamhmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d4xrqa1:

Click to download the PDB-style file with coordinates for d4xrqa1.
(The format of our PDB-style files is described here.)

Timeline for d4xrqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xrqa2