Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (12 PDB entries) |
Domain d4rfeb2: 4rfe B:108-208 [274916] Other proteins in same PDB: d4rfeb1, d4rfed1, d4rfef1, d4rfel1 automated match to d2fb4l2 complexed with cl, gol, so4 |
PDB Entry: 4rfe (more details), 1.91 Å
SCOPe Domain Sequences for d4rfeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rfeb2 b.1.1.2 (B:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} qpkasplvtlfppsseelqankatlvclisdfypgvvkvawkadgnsvntgvetttpskq snnkyaassylsltsdqwkshksyscqvthegstvektvap
Timeline for d4rfeb2: