SCOPe 2.06: Domain d2mqfa1: 2mqf A:2-34

Lineage for d2mqfa1 (2mqf A:2-34)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.6: omega toxin-like [57059] (5 families)

5. Family g.3.6.2: Spider toxins [57072] (26 proteins)

6. Protein automated matches [254476] (8 species)
   not a true protein

7. Species Haplopelma hainanum [TaxId:209901] [274882] (2 PDB entries)

8. Domain d2mqfa1: 2mqf A:2-34 [274883]
   Other proteins in same PDB: d2mqfa2
   automated match to d1nixa_

Details for d2mqfa1

PDB Entry: 2mqf

PDB Description: nmr structure of spider toxin-trtx-hhn2b

PDB Compounds: (A:) Mu-theraphotoxin-Hhn2b

SCOPe Domain Sequences for d2mqfa1:

Sequence; same for both SEQRES and ATOM records:

>d2mqfa1 g.3.6.2 (A:2-34) automated matches {Haplopelma hainanum [TaxId: 209901]}
eckgfgkscvpgkneccsgyacnsrdkwckvll

Timeline for d2mqfa1:

• d2mqfa1 first appeared in SCOPe 2.05, called d2mqfa_
  
• d2mqfa1 appears in SCOPe 2.07
  
• d2mqfa1 appears in the current release, SCOPe 2.08