Lineage for d1nixa_ (1nix A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257383Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 2257424Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 2257448Protein Hainantoxin-I [82879] (1 species)
  7. 2257449Species Spider (Selenocosmia hainana) [TaxId:209901] [82880] (1 PDB entry)
  8. 2257450Domain d1nixa_: 1nix A: [80541]

Details for d1nixa_

PDB Entry: 1nix (more details)

PDB Description: three dimensional solution structure of hainantoxin-i by 2d 1h-nmr
PDB Compounds: (A:) hainantoxin-I

SCOPe Domain Sequences for d1nixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nixa_ g.3.6.2 (A:) Hainantoxin-I {Spider (Selenocosmia hainana) [TaxId: 209901]}
eckgfgkscvpgkneccsgyacnsrdkwckvll

SCOPe Domain Coordinates for d1nixa_:

Click to download the PDB-style file with coordinates for d1nixa_.
(The format of our PDB-style files is described here.)

Timeline for d1nixa_: