SCOPe 2.06: Domain d4tsal2: 4tsa L:108-210

Lineage for d4tsal2 (4tsa L:108-210)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4tsal2: 4tsa L:108-210 [274749]
   Other proteins in same PDB: d4tsal1
   automated match to d1aqkl2

Details for d4tsal2

PDB Entry: 4tsa, 2.27 Å

PDB Description: structure of a lysozyme fab complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4tsal2:

Sequence, based on SEQRES records:

>d4tsal2 b.1.1.2 (L:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Sequence, based on observed residues (ATOM records):

>d4tsal2 b.1.1.2 (L:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshsyscqvthegstvektvat

Timeline for d4tsal2:

• d4tsal2 first appeared in SCOPe 2.05
  
• d4tsal2 appears in SCOPe 2.07
  
• d4tsal2 appears in the current release, SCOPe 2.08