![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (6 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:446] [274374] (1 PDB entry) |
![]() | Domain d4yo1a1: 4yo1 A:240-337 [274375] automated match to d1ky9a1 complexed with cd |
PDB Entry: 4yo1 (more details), 2.8 Å
SCOPe Domain Sequences for d4yo1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yo1a1 b.36.1.0 (A:240-337) automated matches {Legionella pneumophila [TaxId: 446]} ihrglmgifvqhltpelaqsmgyaedfqgalvsqvnqnspaqlaglksgdvivqindtki tqatqvkttisllragstakikilrdnkpltldvevtd
Timeline for d4yo1a1: