Lineage for d4yo1a1 (4yo1 A:240-337)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1786401Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1786402Protein automated matches [190436] (6 species)
    not a true protein
  7. 1786565Species Legionella pneumophila [TaxId:446] [274374] (1 PDB entry)
  8. 1786566Domain d4yo1a1: 4yo1 A:240-337 [274375]
    automated match to d1ky9a1
    complexed with cd

Details for d4yo1a1

PDB Entry: 4yo1 (more details), 2.8 Å

PDB Description: structure of legionella pneumophila degq (delta pdz2 variant)
PDB Compounds: (A:) DegQ

SCOPe Domain Sequences for d4yo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yo1a1 b.36.1.0 (A:240-337) automated matches {Legionella pneumophila [TaxId: 446]}
ihrglmgifvqhltpelaqsmgyaedfqgalvsqvnqnspaqlaglksgdvivqindtki
tqatqvkttisllragstakikilrdnkpltldvevtd

SCOPe Domain Coordinates for d4yo1a1:

Click to download the PDB-style file with coordinates for d4yo1a1.
(The format of our PDB-style files is described here.)

Timeline for d4yo1a1: