Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4ya4v_: 4ya4 V: [274076] Other proteins in same PDB: d4ya4a_, d4ya4e_, d4ya4g_, d4ya4i_, d4ya4j_, d4ya4k_, d4ya4l_, d4ya4n_, d4ya4o_, d4ya4s_, d4ya4u_, d4ya4w_, d4ya4x_, d4ya4y_, d4ya4z_ automated match to d4r17h_ complexed with cl, mg; mutant |
PDB Entry: 4ya4 (more details), 2.9 Å
SCOPe Domain Sequences for d4ya4v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ya4v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsidahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4ya4v_: