Lineage for d4y8rh_ (4y8r H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229405Domain d4y8rh_: 4y8r H: [273956]
    Other proteins in same PDB: d4y8ra_, d4y8re_, d4y8rg_, d4y8ri_, d4y8rj_, d4y8rk_, d4y8rl_, d4y8rn_, d4y8ro_, d4y8rs_, d4y8ru_, d4y8rw_, d4y8rx_, d4y8ry_, d4y8rz_
    automated match to d4r17h_
    complexed with cl, mes, mg; mutant

Details for d4y8rh_

PDB Entry: 4y8r (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta2-h116d mutant
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4y8rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8rh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihadgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4y8rh_:

Click to download the PDB-style file with coordinates for d4y8rh_.
(The format of our PDB-style files is described here.)

Timeline for d4y8rh_: