Lineage for d4y8re_ (4y8r E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225861Domain d4y8re_: 4y8r E: [273955]
    Other proteins in same PDB: d4y8ra_, d4y8rb_, d4y8rc_, d4y8rd_, d4y8rf_, d4y8rh_, d4y8ri_, d4y8rj_, d4y8rk_, d4y8rl_, d4y8rm_, d4y8rn_, d4y8ro_, d4y8rp_, d4y8rq_, d4y8rr_, d4y8rt_, d4y8rv_, d4y8rw_, d4y8rx_, d4y8ry_, d4y8rz_
    automated match to d4g4sf_
    complexed with cl, mes, mg; mutant

Details for d4y8re_

PDB Entry: 4y8r (more details), 2.7 Å

PDB Description: yeast 20s proteasome beta2-h116d mutant
PDB Compounds: (E:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d4y8re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8re_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d4y8re_:

Click to download the PDB-style file with coordinates for d4y8re_.
(The format of our PDB-style files is described here.)

Timeline for d4y8re_: