Lineage for d4qryg_ (4qry G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252282Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2252283Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2252559Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2252560Protein automated matches [226845] (16 species)
    not a true protein
  7. 2252605Species Natronomonas pharaonis [TaxId:2257] [256038] (6 PDB entries)
  8. 2252629Domain d4qryg_: 4qry G: [273910]
    automated match to d3qbga_
    complexed with bng, br, l2p, ret

Details for d4qryg_

PDB Entry: 4qry (more details), 2.2 Å

PDB Description: the ground state and the n intermediate of pharaonis halorhodopsin in complex with bromide ion
PDB Compounds: (G:) halorhodopsin

SCOPe Domain Sequences for d4qryg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qryg_ f.13.1.0 (G:) automated matches {Natronomonas pharaonis [TaxId: 2257]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsg

SCOPe Domain Coordinates for d4qryg_:

Click to download the PDB-style file with coordinates for d4qryg_.
(The format of our PDB-style files is described here.)

Timeline for d4qryg_: