SCOPe 2.08: Domain d4qryg_: 4qry G:

Lineage for d4qryg_ (4qry G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Natronomonas pharaonis [TaxId:2257] [256038] (6 PDB entries)

8. Domain d4qryg_: 4qry G: [273910]
   automated match to d3qbga_
   complexed with bng, br, l2p, ret

Details for d4qryg_

PDB Entry: 4qry, 2.2 Å

PDB Description: the ground state and the n intermediate of pharaonis halorhodopsin in complex with bromide ion

PDB Compounds: (G:) halorhodopsin

SCOPe Domain Sequences for d4qryg_:

Sequence; same for both SEQRES and ATOM records:

>d4qryg_ f.13.1.0 (G:) automated matches {Natronomonas pharaonis [TaxId: 2257]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsg

Timeline for d4qryg_:

• d4qryg_ first appeared in SCOPe 2.05
  
• d4qryg_ appears in SCOPe 2.07