SCOPe 2.08: Domain d4x50a_: 4x50 A:

Lineage for d4x50a_ (4x50 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries)

8. Domain d4x50a_: 4x50 A: [273016]
   automated match to d3zl2a_
   complexed with 3x8

Details for d4x50a_

PDB Entry: 4x50, 2 Å

PDB Description: crystal structure of fimh in complex with biphenyl alpha-d- mannopyranoside

PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d4x50a_:

Sequence; same for both SEQRES and ATOM records:

>d4x50a_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4x50a_:

• d4x50a_ first appeared in SCOPe 2.05
  
• d4x50a_ appears in SCOPe 2.07