Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Bacillus cereus [TaxId:526980] [269753] (4 PDB entries) |
Domain d4qf6g_: 4qf6 G: [272967] automated match to d4fr8a_ complexed with na; mutant |
PDB Entry: 4qf6 (more details), 1.9 Å
SCOPe Domain Sequences for d4qf6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qf6g_ c.82.1.0 (G:) automated matches {Bacillus cereus [TaxId: 526980]} nielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavk aarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisat venyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalat gctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftg stvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsags rvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegat vaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyg laagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyt evksvwvnik
Timeline for d4qf6g_: