PDB entry 4qf6

View 4qf6 on RCSB PDB site
Description: Structure of Aldehyde Dehydrogenase from Bacillus cereus, E194S mutant
Class: oxidoreductase
Keywords: Rossmann, Aldehyde Dehydrogenase, OXIDOREDUCTASE, E194S
Deposited on 2014-05-19, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6d_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6e_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6f_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6h_
  • Chain 'I':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6i_
  • Chain 'J':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6j_
  • Chain 'K':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6k_
  • Chain 'L':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2N217 (Start-493)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d4qf6l_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qf6A (A:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6A (A:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qf6B (B:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6B (B:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qf6C (C:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6C (C:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qf6D (D:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6D (D:)
    ielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavka
    arsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatv
    enyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatg
    ctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgs
    tvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsr
    vfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatv
    aaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygl
    aagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyte
    vksvwvnik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qf6E (E:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6E (E:)
    nielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavk
    aarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisat
    venyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalat
    gctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftg
    stvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsags
    rvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegat
    vaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyg
    laagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyt
    evksvwvnik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qf6F (F:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6F (F:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qf6G (G:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6G (G:)
    nielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavk
    aarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisat
    venyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalat
    gctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftg
    stvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsags
    rvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegat
    vaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyg
    laagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyt
    evksvwvnik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qf6H (H:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6H (H:)
    nielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavk
    aarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisat
    venyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalat
    gctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftg
    stvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsags
    rvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegat
    vaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyg
    laagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyt
    evksvwvnik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qf6I (I:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6I (I:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4qf6J (J:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6J (J:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4qf6K (K:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6K (K:)
    ielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavka
    arsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatv
    enyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatg
    ctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgs
    tvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsr
    vfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatv
    aaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygl
    aagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyte
    vksvwvnik
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4qf6L (L:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf6L (L:)
    elkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavkaa
    rsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatve
    nyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatgc
    tivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgst
    vtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsrv
    fvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatva
    aggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygla
    agvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnytev
    ksvwvnik