Lineage for d1vwkb_ (1vwk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805881Domain d1vwkb_: 1vwk B: [27266]
    complexed with lea

Details for d1vwkb_

PDB Entry: 1vwk (more details), 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vwkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwkb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1vwkb_:

Click to download the PDB-style file with coordinates for d1vwkb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwkb_: