Lineage for d2izka_ (2izk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805897Domain d2izka_: 2izk A: [27255]
    complexed with act, gll, so4

Details for d2izka_

PDB Entry: 2izk (more details), 1.3 Å

PDB Description: streptavidin-glycoluril ph 2.58 i4122 complex
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2izka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izka_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d2izka_:

Click to download the PDB-style file with coordinates for d2izka_.
(The format of our PDB-style files is described here.)

Timeline for d2izka_: