Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries) |
Domain d4wmra1: 4wmr A:173-321 [272411] Other proteins in same PDB: d4wmra2 automated match to d2kbwa_ complexed with 865, pop, zn |
PDB Entry: 4wmr (more details), 1.7 Å
SCOPe Domain Sequences for d4wmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wmra1 f.1.4.1 (A:173-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} elyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgml rkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplae sitdvlvrtkrdwlvkqrgwdgfveffhv
Timeline for d4wmra1: