![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) ![]() |
![]() | Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
![]() | Protein automated matches [190706] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [271918] (1 PDB entry) |
![]() | Domain d4pyde_: 4pyd E: [271925] automated match to d2eeya_ complexed with 8cs, dtt, edo, gol |
PDB Entry: 4pyd (more details), 3.19 Å
SCOPe Domain Sequences for d4pyde_:
Sequence, based on SEQRES records: (download)
>d4pyde_ d.58.21.0 (E:) automated matches {Escherichia coli [TaxId: 83333]} aageahmvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakr twdliplchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiyd mckavqkdmvigpvrllaks
>d4pyde_ d.58.21.0 (E:) automated matches {Escherichia coli [TaxId: 83333]} aageahmvdvsakaetvrearaeafvtmrsetlamiidvfatariagiqaakrtwdlipl chplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiydmckavqk dmvigpvrllaks
Timeline for d4pyde_:
![]() Domains from other chains: (mouse over for more information) d4pyda_, d4pydb_, d4pydc_, d4pydd_ |