Lineage for d4pyde_ (4pyd E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561313Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2561319Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2561320Protein automated matches [190706] (6 species)
    not a true protein
  7. 2561321Species Escherichia coli [TaxId:83333] [271918] (1 PDB entry)
  8. 2561326Domain d4pyde_: 4pyd E: [271925]
    automated match to d2eeya_
    complexed with 8cs, dtt, edo, gol

Details for d4pyde_

PDB Entry: 4pyd (more details), 3.19 Å

PDB Description: moac in complex with cpmp crystallized in space group p212121
PDB Compounds: (E:) Molybdenum cofactor biosynthesis protein MoaC

SCOPe Domain Sequences for d4pyde_:

Sequence, based on SEQRES records: (download)

>d4pyde_ d.58.21.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
aageahmvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakr
twdliplchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiyd
mckavqkdmvigpvrllaks

Sequence, based on observed residues (ATOM records): (download)

>d4pyde_ d.58.21.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
aageahmvdvsakaetvrearaeafvtmrsetlamiidvfatariagiqaakrtwdlipl
chplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiydmckavqk
dmvigpvrllaks

SCOPe Domain Coordinates for d4pyde_:

Click to download the PDB-style file with coordinates for d4pyde_.
(The format of our PDB-style files is described here.)

Timeline for d4pyde_: