SCOPe 2.05: Domain d4ozgd1: 4ozg D:3-92

Lineage for d4ozgd1 (4ozg D:3-92)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4ozgd1: 4ozg D:3-92 [271656]
   Other proteins in same PDB: d4ozga2, d4ozgb2, d4ozgc2, d4ozgd2, d4ozgg1, d4ozgg2
   automated match to d1klub2
   complexed with ca, nag

Details for d4ozgd1

PDB Entry: 4ozg, 3 Å

PDB Description: d2 protein complex

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozgd1:

Sequence; same for both SEQRES and ATOM records:

>d4ozgd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

Timeline for d4ozgd1:

• d4ozgd1 is new in SCOPe 2.05-stable
  
• d4ozgd1 appears in SCOPe 2.06
  
• d4ozgd1 appears in the current release, SCOPe 2.08