SCOPe 2.05: Domain d4ozgg1: 4ozg G:2-129

Lineage for d4ozgg1 (4ozg G:2-129)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4ozgg1: 4ozg G:2-129 [271654]
   Other proteins in same PDB: d4ozga1, d4ozga2, d4ozgb1, d4ozgc1, d4ozgc2, d4ozgd1, d4ozgg2
   automated match to d2pyfa1
   complexed with ca, nag

Details for d4ozgg1

PDB Entry: 4ozg, 3 Å

PDB Description: d2 protein complex

PDB Compounds: (G:) T-cell receptor, d2, alpha chain

SCOPe Domain Sequences for d4ozgg1:

Sequence; same for both SEQRES and ATOM records:

>d4ozgg1 b.1.1.0 (G:2-129) automated matches {Homo sapiens [TaxId: 9606]}
mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyycivlggadgltfgkgthliiqpy

Timeline for d4ozgg1:

• d4ozgg1 is new in SCOPe 2.05-stable
  
• d4ozgg1 appears in SCOPe 2.06
  
• d4ozgg1 appears in the current release, SCOPe 2.08