Lineage for d4xq5a_ (4xq5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776610Species Influenza A virus [TaxId:1458555] [271092] (2 PDB entries)
  8. 2776611Domain d4xq5a_: 4xq5 A: [271093]
    Other proteins in same PDB: d4xq5b_, d4xq5d_, d4xq5f_
    automated match to d3gbna_
    complexed with nag

Details for d4xq5a_

PDB Entry: 4xq5 (more details), 2.59 Å

PDB Description: human-infecting h10n8 influenza virus retains strong preference for avian-type receptors
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4xq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xq5a_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1458555]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d4xq5a_:

Click to download the PDB-style file with coordinates for d4xq5a_.
(The format of our PDB-style files is described here.)

Timeline for d4xq5a_: