Lineage for d4y95d_ (4y95 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589773Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)
  8. 2589785Domain d4y95d_: 4y95 D: [270917]
    Other proteins in same PDB: d4y95a2, d4y95b2, d4y95c2
    automated match to d3pj2a_
    complexed with 746, bme, gol, pe4; mutant

Details for d4y95d_

PDB Entry: 4y95 (more details), 1.6 Å

PDB Description: crystal structure of the kinase domain of bruton's tyrosine kinase with mutations in the activation loop
PDB Compounds: (D:) Non-specific protein-tyrosine kinase

SCOPe Domain Sequences for d4y95d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y95d_ d.144.1.7 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
kqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmyskf
ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimyscw
hekaderptfkillsnildvmdees

SCOPe Domain Coordinates for d4y95d_:

Click to download the PDB-style file with coordinates for d4y95d_.
(The format of our PDB-style files is described here.)

Timeline for d4y95d_: