![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries) |
![]() | Domain d4y95c1: 4y95 C:395-659 [270916] Other proteins in same PDB: d4y95a2, d4y95b2, d4y95c2 automated match to d3pj2a_ complexed with 746, bme, gol, pe4; mutant |
PDB Entry: 4y95 (more details), 1.6 Å
SCOPe Domain Sequences for d4y95c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y95c1 d.144.1.7 (C:395-659) automated matches {Cow (Bos taurus) [TaxId: 9913]} weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles kqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmyskf ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimyscw hekaderptfkillsnildvmdees
Timeline for d4y95c1: