SCOPe 2.07: Domain d4y95a1: 4y95 A:395-659

Lineage for d4y95a1 (4y95 A:395-659)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)

8. Domain d4y95a1: 4y95 A:395-659 [270915]
   Other proteins in same PDB: d4y95a2, d4y95b2, d4y95c2
   automated match to d3pj2a_
   complexed with 746, bme, gol, pe4; mutant

Details for d4y95a1

PDB Entry: 4y95, 1.6 Å

PDB Description: crystal structure of the kinase domain of bruton's tyrosine kinase with mutations in the activation loop

PDB Compounds: (A:) Non-specific protein-tyrosine kinase

SCOPe Domain Sequences for d4y95a1:

Sequence; same for both SEQRES and ATOM records:

>d4y95a1 d.144.1.7 (A:395-659) automated matches {Cow (Bos taurus) [TaxId: 9913]}
weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
kqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmyskf
ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimyscw
hekaderptfkillsnildvmdees

Timeline for d4y95a1:

• d4y95a1 first appeared in SCOPe 2.05, called d4y95a_
  
• d4y95a1 appears in SCOPe 2.06
  
• d4y95a1 appears in the current release, SCOPe 2.08