Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
Species Escherichia coli [TaxId:562] [110237] (12 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d4rr1c1: 4rr1 C:43-254 [269873] Other proteins in same PDB: d4rr1a2, d4rr1a3, d4rr1b2, d4rr1b3, d4rr1b4, d4rr1c2 automated match to d1sota2 complexed with ni, po4 |
PDB Entry: 4rr1 (more details), 2.3 Å
SCOPe Domain Sequences for d4rr1c1:
Sequence, based on SEQRES records: (download)
>d4rr1c1 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk sndgetpegigfaipfqlatkimdklirdgrv
>d4rr1c1 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrgleirtlgsgvimdqrgyiitnkhvindadqiivalqd grvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignlgqtitqgii satgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlpegigfaipfqlatk imdklirdgrv
Timeline for d4rr1c1: