SCOPe 2.08: Domain d4rr1c1: 4rr1 C:43-254

Lineage for d4rr1c1 (4rr1 C:43-254)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d4rr1c1: 4rr1 C:43-254 [269873]
   Other proteins in same PDB: d4rr1a2, d4rr1a3, d4rr1b2, d4rr1b3, d4rr1b4, d4rr1c2
   automated match to d1sota2
   complexed with ni, po4

Details for d4rr1c1

PDB Entry: 4rr1, 2.3 Å

PDB Description: re-refinement of entry 1sot, crystal structure of the degs stress sensor

PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d4rr1c1:

Sequence, based on SEQRES records:

>d4rr1c1 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdgrv

Sequence, based on observed residues (ATOM records):

>d4rr1c1 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrgleirtlgsgvimdqrgyiitnkhvindadqiivalqd
grvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignlgqtitqgii
satgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlpegigfaipfqlatk
imdklirdgrv

Timeline for d4rr1c1:

• d4rr1c1 first appeared in SCOPe 2.05
  
• d4rr1c1 appears in SCOPe 2.07