Lineage for d1dbha2 (1dbh A:418-550)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
Pfam PF00169
Protein Son of sevenless-1 (sos-1) [50742] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries)
Uniprot Q07889 189-1046
Domain d1dbha2: 1dbh A:418-550 [26967]
Other proteins in same PDB: d1dbha1
Details for d1dbha2
PDB Entry: 1dbh (more details), 2.3 Å
PDB Description: dbl and pleckstrin homology domains from hsos1
PDB Compounds: (A:) protein (human sos 1)SCOPe Domain Sequences for d1dbha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
aikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgq
prlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnw
maalislqyrstl
SCOPe Domain Coordinates for d1dbha2:
Click to download the PDB-style file with coordinates for d1dbha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dbha2:
- d1dbha2 first appeared (with stable ids) in SCOP 1.55
- d1dbha2 appears in SCOPe 2.07
View in 3D
