SCOPe 2.08: Domain d4ci6a1: 4ci6 A:5-146

Lineage for d4ci6a1 (4ci6 A:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [269613] (2 PDB entries)

8. Domain d4ci6a1: 4ci6 A:5-146 [269616]
   Other proteins in same PDB: d4ci6a2
   automated match to d2btfa1
   complexed with atp, ca

Details for d4ci6a1

PDB Entry: 4ci6, 2.65 Å

PDB Description: mechanisms of crippling actin-dependent phagocytosis by yopo

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d4ci6a1:

Sequence, based on SEQRES records:

>d4ci6a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfnspamhvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d4ci6a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfnspamhvai
qavlslyasg

Timeline for d4ci6a1:

• d4ci6a1 first appeared in SCOPe 2.05
  
• d4ci6a1 appears in SCOPe 2.07