Lineage for d4ci6a1 (4ci6 A:5-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492863Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [269613] (2 PDB entries)
  8. 2492864Domain d4ci6a1: 4ci6 A:5-146 [269616]
    Other proteins in same PDB: d4ci6a2
    automated match to d2btfa1
    complexed with atp, ca

Details for d4ci6a1

PDB Entry: 4ci6 (more details), 2.65 Å

PDB Description: mechanisms of crippling actin-dependent phagocytosis by yopo
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d4ci6a1:

Sequence, based on SEQRES records: (download)

>d4ci6a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfnspamhvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4ci6a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfnspamhvai
qavlslyasg

SCOPe Domain Coordinates for d4ci6a1:

Click to download the PDB-style file with coordinates for d4ci6a1.
(The format of our PDB-style files is described here.)

Timeline for d4ci6a1: