Lineage for d5aena3 (5aen A:461-610)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010204Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2010205Protein automated matches [190220] (14 species)
    not a true protein
  7. 2010232Species Human (Homo sapiens) [TaxId:9606] [189070] (42 PDB entries)
  8. 2010244Domain d5aena3: 5aen A:461-610 [269608]
    Other proteins in same PDB: d5aena1, d5aena2
    automated match to d3u9wa3
    complexed with dp8, imd, yb, zn

Details for d5aena3

PDB Entry: 5aen (more details), 1.86 Å

PDB Description: structure of human leukotriene a4 hydrolase in complex with inhibitor dimethyl(2- (4-phenoxyphenoxy)ethyl)amine
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5aena3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aena3 a.118.1.0 (A:461-610) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d5aena3:

Click to download the PDB-style file with coordinates for d5aena3.
(The format of our PDB-style files is described here.)

Timeline for d5aena3: