SCOPe 2.06: Domain d5aena1: 5aen A:3-208

Lineage for d5aena1 (5aen A:3-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries)

8. Domain d5aena1: 5aen A:3-208 [269604]
   Other proteins in same PDB: d5aena2, d5aena3
   automated match to d3b7sa2
   complexed with dp8, imd, yb, zn

Details for d5aena1

PDB Entry: 5aen, 1.86 Å

PDB Description: structure of human leukotriene a4 hydrolase in complex with inhibitor dimethyl(2- (4-phenoxyphenoxy)ethyl)amine

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5aena1:

Sequence; same for both SEQRES and ATOM records:

>d5aena1 b.98.1.0 (A:3-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

Timeline for d5aena1:

• d5aena1 first appeared in SCOPe 2.05
  
• d5aena1 appears in SCOPe 2.07
  
• d5aena1 appears in the current release, SCOPe 2.08