SCOPe 2.08: Domain d1eu1a1: 1eu1 A:626-780

Lineage for d1eu1a1 (1eu1 A:626-780)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Dimethylsulfoxide reductase (DMSO reductase) [50697] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50698] (1 PDB entry)

8. Domain d1eu1a1: 1eu1 A:626-780 [26903]
   Other proteins in same PDB: d1eu1a2
   complexed with 6mo, cd, epe, glc, mgd, o, so4

Details for d1eu1a1

PDB Entry: 1eu1, 1.3 Å

PDB Description: the crystal structure of rhodobacter sphaeroides dimethylsulfoxide reductase reveals two distinct molybdenum coordination environments.

PDB Compounds: (A:) dimethyl sulfoxide reductase

SCOPe Domain Sequences for d1eu1a1:

Sequence; same for both SEQRES and ATOM records:

>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]}
erlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinpadaaargiadgd
vlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldkygdvnvlsldvgt
sklaqgncgqtiladvekyagapvtvtvfdtpkga

Timeline for d1eu1a1:

• d1eu1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eu1a1 appears in SCOPe 2.07