Lineage for d4u1ab1 (4u1a B:103-345)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112573Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2112751Protein automated matches [190669] (6 species)
    not a true protein
  7. 2112766Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries)
  8. 2112783Domain d4u1ab1: 4u1a B:103-345 [268883]
    Other proteins in same PDB: d4u1ab2, d4u1ac2
    automated match to d2f6qc_
    complexed with cl; mutant

Details for d4u1ab1

PDB Entry: 4u1a (more details), 2.85 Å

PDB Description: Crystal structure of human peroxisomal delta3,delta2, enoyl-CoA isomerase helix-10 deletion mutant (ISOB-ECI2)
PDB Compounds: (B:) Enoyl-CoA delta isomerase 2

SCOPe Domain Sequences for d4u1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u1ab1 c.14.1.3 (B:103-345) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
sgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglf
davyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglv
tevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwls
dec

SCOPe Domain Coordinates for d4u1ab1:

Click to download the PDB-style file with coordinates for d4u1ab1.
(The format of our PDB-style files is described here.)

Timeline for d4u1ab1: