Lineage for d4r68d1 (4r68 D:1-159)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105660Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (16 PDB entries)
  8. 2105680Domain d4r68d1: 4r68 D:1-159 [268692]
    Other proteins in same PDB: d4r68a2, d4r68b2, d4r68c2, d4r68d2
    automated match to d1i10d1
    complexed with epe, nai, so4, w31

Details for d4r68d1

PDB Entry: 4r68 (more details), 2.11 Å

PDB Description: Lactate Dehydrogenase in complex with inhibitor compound 31
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4r68d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r68d1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4r68d1:

Click to download the PDB-style file with coordinates for d4r68d1.
(The format of our PDB-style files is described here.)

Timeline for d4r68d1: