Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (16 PDB entries) |
Domain d4r68d1: 4r68 D:1-159 [268692] Other proteins in same PDB: d4r68a2, d4r68b2, d4r68c2, d4r68d2 automated match to d1i10d1 complexed with epe, nai, so4, w31 |
PDB Entry: 4r68 (more details), 2.11 Å
SCOPe Domain Sequences for d4r68d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r68d1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4r68d1: