Lineage for d4r68b2 (4r68 B:160-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232608Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (16 PDB entries)
  8. 2232626Domain d4r68b2: 4r68 B:160-331 [268703]
    Other proteins in same PDB: d4r68a1, d4r68b1, d4r68c1, d4r68d1
    automated match to d1i10d2
    complexed with epe, nai, so4, w31

Details for d4r68b2

PDB Entry: 4r68 (more details), 2.11 Å

PDB Description: Lactate Dehydrogenase in complex with inhibitor compound 31
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4r68b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r68b2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4r68b2:

Click to download the PDB-style file with coordinates for d4r68b2.
(The format of our PDB-style files is described here.)

Timeline for d4r68b2: