Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.143: SAICAR synthase-like [56103] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies |
Family d.143.1.0: automated matches [191445] (1 protein) not a true family |
Protein automated matches [190664] (8 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [194472] (16 PDB entries) |
Domain d4o7sa_: 4o7s A: [268455] automated match to d2z02a_ complexed with act, po4, tmp, tyd |
PDB Entry: 4o7s (more details), 2.24 Å
SCOPe Domain Sequences for d4o7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o7sa_ d.143.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgikthfigvag gnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyykndelhdpminyy hakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngdivladeisp dtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekpef
Timeline for d4o7sa_: