SCOPe 2.06: Domain d4mv8a2: 4mv8 A:115-330

Lineage for d4mv8a2 (4mv8 A:115-330)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [268353] (8 PDB entries)

8. Domain d4mv8a2: 4mv8 A:115-330 [268354]
   Other proteins in same PDB: d4mv8a1, d4mv8a3
   automated match to d1dv2a3
   complexed with acp, po4

Details for d4mv8a2

PDB Entry: 4mv8, 2.06 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and phosphate

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv8a2:

Sequence, based on SEQRES records:

>d4mv8a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasgggggrgmrvvrs
edaleesiamtkaeakaafnndmvymekylenprhveiqvladthgnavylaerdcsmqr
rhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflyengefyfiemntriq
vehpvtemitgvdlvkeqlriaaglpisfkqedikv

Sequence, based on observed residues (ATOM records):

>d4mv8a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasggmrvvrsedale
esiamtdmvymekylenprhveiqvladthgnavylaerdcsmqrrhqkvveeapapgit
eevrrdigsrcanacveigyrgagtfeflyengefyfiemntriqvehpvtemitgvdlv
keqlriaaglpisfkqedikv

Timeline for d4mv8a2:

• d4mv8a2 first appeared in SCOPe 2.05
  
• d4mv8a2 appears in SCOPe 2.07
  
• d4mv8a2 appears in the current release, SCOPe 2.08