SCOPe 2.05: Domain d4kbqa_: 4kbq A:

Lineage for d4kbqa_ (4kbq A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (2 PDB entries)

8. Domain d4kbqa_: 4kbq A: [268316]
   Other proteins in same PDB: d4kbqc1, d4kbqd1
   automated match to d2vyib_

Details for d4kbqa_

PDB Entry: 4kbq, 2.91 Å

PDB Description: structure of the chip-tpr domain in complex with the hsc70 lid-tail domains

PDB Compounds: (A:) E3 ubiquitin-protein ligase CHIP

SCOPe Domain Sequences for d4kbqa_:

Sequence; same for both SEQRES and ATOM records:

>d4kbqa_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqaladc
rraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalriak
kkrwnsieer

Timeline for d4kbqa_:

• d4kbqa_ is new in SCOPe 2.05-stable
  
• d4kbqa_ appears in SCOPe 2.06
  
• d4kbqa_ appears in the current release, SCOPe 2.08