Lineage for d2vyib_ (2vyi B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746069Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1746070Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1746163Protein automated matches [190103] (4 species)
    not a true protein
  7. 1746168Species Human (Homo sapiens) [TaxId:9606] [186825] (10 PDB entries)
  8. 1746172Domain d2vyib_: 2vyi B: [231362]
    automated match to d2vyia1

Details for d2vyib_

PDB Entry: 2vyi (more details), 2.4 Å

PDB Description: crystal structure of the tpr domain of human sgt
PDB Compounds: (B:) sgta protein

SCOPe Domain Sequences for d2vyib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyib_ a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagav
qdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
lrea

SCOPe Domain Coordinates for d2vyib_:

Click to download the PDB-style file with coordinates for d2vyib_.
(The format of our PDB-style files is described here.)

Timeline for d2vyib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vyia_