Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein automated matches [190103] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186825] (8 PDB entries) |
Domain d2vyia1: 2vyi A:91-205 [153706] automatically matched to d1na0a_ |
PDB Entry: 2vyi (more details), 2.4 Å
SCOPe Domain Sequences for d2vyia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyia1 a.118.8.1 (A:91-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} aerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagavqdcer aicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
Timeline for d2vyia1: