Lineage for d2vyia1 (2vyi A:91-205)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (9 families) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein automated matches [190103] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186825] (8 PDB entries) 
Domain d2vyia1: 2vyi A:91-205 [153706]
automatically matched to d1na0a_
Details for d2vyia1
PDB Entry: 2vyi (more details), 2.4 Å
PDB Description: crystal structure of the tpr domain of human sgt
PDB Compounds: (A:) sgta proteinSCOPe Domain Sequences for d2vyia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyia1 a.118.8.1 (A:91-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagavqdcer
aicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
SCOPe Domain Coordinates for d2vyia1:
Click to download the PDB-style file with coordinates for d2vyia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vyia1:
- d2vyia1 first appeared in SCOP 1.75
- d2vyia1 appears in SCOPe 2.02
- d2vyia1 is called d2vyia_ in SCOPe 2.04
- d2vyia1 appears in the current release, SCOPe 2.08, called d2vyia_
View in 3D
