Lineage for d4c5ab1 (4c5a B:3-96)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470665Species Escherichia coli [TaxId:83333] [268126] (3 PDB entries)
  8. 2470671Domain d4c5ab1: 4c5a B:3-96 [268133]
    Other proteins in same PDB: d4c5aa2, d4c5ab2
    automated match to d1iowa1
    complexed with adp, ds0, gol, mg

Details for d4c5ab1

PDB Entry: 4c5a (more details), 1.65 Å

PDB Description: the x-ray crystal structures of d-alanyl-d-alanine ligase in complex adp and d-cycloserine phosphate
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4c5ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c5ab1 c.30.1.0 (B:3-96) automated matches {Escherichia coli [TaxId: 83333]}
dkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfial
hgrggedgtlqgmlelmglpytgsgvmasalsmd

SCOPe Domain Coordinates for d4c5ab1:

Click to download the PDB-style file with coordinates for d4c5ab1.
(The format of our PDB-style files is described here.)

Timeline for d4c5ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c5ab2