Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (28 species) not a true protein |
Species Escherichia coli [TaxId:83333] [268126] (3 PDB entries) |
Domain d4c5ab1: 4c5a B:3-96 [268133] Other proteins in same PDB: d4c5aa2, d4c5ab2 automated match to d1iowa1 complexed with adp, ds0, gol, mg |
PDB Entry: 4c5a (more details), 1.65 Å
SCOPe Domain Sequences for d4c5ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c5ab1 c.30.1.0 (B:3-96) automated matches {Escherichia coli [TaxId: 83333]} dkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfial hgrggedgtlqgmlelmglpytgsgvmasalsmd
Timeline for d4c5ab1: