Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins) |
Protein automated matches [268128] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [268129] (3 PDB entries) |
Domain d4c5ab2: 4c5a B:97-306 [268134] Other proteins in same PDB: d4c5aa1, d4c5ab1 automated match to d1iova2 complexed with adp, ds0, gol, mg |
PDB Entry: 4c5a (more details), 1.65 Å
SCOPe Domain Sequences for d4c5ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c5ab2 d.142.1.1 (B:97-306) automated matches {Escherichia coli [TaxId: 83333]} klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg mtshslvpmaarqagmsfsqlvvrilelad
Timeline for d4c5ab2: